pi24ddlZddlZddlZddlmZddlmZddlmZddl m Z ddl m Z ddl mZGddZGd d Zed gd Zd ZGddZedddgZGddeZy)N) namedtuple)Sequence)contextmanager)cached_property)configc(eZdZdZdgZdZdZdZy)RecordLLVMPassTimingsLegacy9A helper context manager to track LLVM pass timings. _datac0tjd|S))Enables the pass timing in LLVM. T)llvmset_time_passesselfs ^/opt/services/ai/voice_agent/venv/lib/python3.12/site-packages/numba/misc/llvm_pass_timings.py __enter__z%RecordLLVMPassTimingsLegacy.__enter__s T" c`tj|_tjdy)2Reset timings and save report internally. FN)rreport_and_reset_timingsr rrexc_valexc_typeexc_tbs r__exit__z$RecordLLVMPassTimingsLegacy.__exit__s%224  U#rc,t|jSztRetrieve timing data for processing. Returns ------- timings: ProcessedPassTimings ProcessedPassTimingsr rs rgetzRecordLLVMPassTimingsLegacy.get!$DJJ//rN)__name__ __module__ __qualname____doc__ __slots__rrr!rrr r s I 0rr c0eZdZdZddgZdZdZdZdZy) RecordLLVMPassTimingsr r _pbc ||_d|_yN)r+r )rpbs r__init__zRecordLLVMPassTimings.__init__1s rc:|jj|S)r )r+start_pass_timingrs rrzRecordLLVMPassTimings.__enter__5s ""$ rcB|jj|_y)rN)r+finish_pass_timingr rs rrzRecordLLVMPassTimings.__exit__;sXX002 rc,t|jSrrrs rr!zRecordLLVMPassTimings.getAr"rN) r#r$r%r&r'r/rrr!r(rrr*r*+s'% I  0rr*PassTimingRecord) user_time user_percent system_timesystem_percentuser_system_timeuser_system_percent wall_time wall_percent pass_name instructionc|djdk(sJfd}dDcgc] }|| c}td|}fd}tt||Scc}w)zAdjust timing records because of truncated information. Details: The percent information can be used to improve the timing information. Returns ------- res: List[PassTimingRecord] Totalc\|d|dtjfd}|S)N_time_percentc8}||zdz}||<|S)z'Compute percent x total_time = adjustedg{Gz?r()dtotaladjusted percent_attr time_attr time_getter total_recs radjustz6_adjust_timings..make_adjuster..adjustns. *Eq.5H#AiLHr)operator attrgetter)attrrNrJrKrLrMs @@@r make_adjusterz&_adjust_timings..make_adjusteris6fEN x( )))4   r)usersystem user_systemwallc"|jSr-)_asdictxs rz!_adjust_timings..}s !))+rc8D] }||} tdi|S)Nr()r5)rGfnadj_fnss rchainedz _adjust_timings..chaineds+ B1A  $!$$r)r>maplist)recordsrRrZdictsr_r^rMs @@r_adjust_timingsrd\sq I   ' )) )  #L aG %w /E% GU# $$sAcReZdZdZdZdZdZdZdZdZ d dZ e d Z d Z y ) r zA class for processing raw timing report from LLVM. The processing is done lazily so we don't waste time processing unused timing information. c||_yr- _raw_data)rraw_datas rr/zProcessedPassTimings.__init__s !rc,t|jSr-)boolrhrs r__bool__zProcessedPassTimings.__bool__sDNN##rc|jS)zWReturns the raw string data. Returns ------- res: str rgrs r get_raw_dataz!ProcessedPassTimings.get_raw_datas~~rc<|jdjS)zhCompute the total time spend in all passes. Returns ------- res: float rA) list_recordsr<rs rget_total_timez#ProcessedPassTimings.get_total_times  "2&000rc|jS)z{Get the processed data for the timing report. Returns ------- res: List[PassTimingRecord] ) _processedrs rrpz!ProcessedPassTimings.list_recordssrc|j}tjd}tj||dd|S)aReturns the top(n) most time-consuming (by wall-time) passes. Parameters ---------- n: int This limits the maximum number of items to show. This function will show the ``n`` most time-consuming passes. Returns ------- res: List[PassTimingRecord] Returns the top(n) most time-consuming passes in descending order. r<NrA)rprOrPheapqnlargest)rnrbkeys rlist_topzProcessedPassTimings.list_tops;##%!!+.~~a"s33rc gd|zfd}|d|jdd|d|j|D]3}|d|jdd|jd d |j5d j S) aReturn a string summarizing the timing information. Parameters ---------- topn: int; optional This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. indent: int; optional Set the indentation level. Defaults to 0 for no indentation. Returns ------- res: str  c0j|yr-)append)argbufprefixs rapz(ProcessedPassTimings.summary..aps JJ&#' (rzTotal .4fsz Top timings:z zs (5z%)  )rqryr<r=r>join)rtopnindentrprrs @@rsummaryzProcessedPassTimings.summarysv ) VD'')#.a 01 >t$ LA AKK$Cq'9Q[[MJ K Lyy~rc"|jS)ztA cached property for lazily processing the data and returning it. See ``_process()`` for details. )_processrs rrszProcessedPassTimings._processeds }}rcTd}t||j}t|S)zParses the raw string data from LLVM timing report and attempts to improve the data by recomputing the times (See `_adjust_timings()``). c 3K|j}d}d|d}t|}dddddd d }|D]R}tj||}|stjd |}|D cgc]} || j } } n d d k(sJg} d } d} | dd D]A} | dk(r| | z } | j | d| j | d| d| d| dz } Ci}tjD]} | | vs| d k7sd|| <| dz } |D]}tj| |}|t|j}t| |D cic]\} }| | t|nd}} }|j||d }tdd |i|}||jdk(sndj|}d|vry|rt!d|ycc} wcc}} ww)zwA generator that parses the raw_data line-by-line to extract timing information for each pass. z [a-zA-Z+ ]+z(?:\s*-+z-+)+rSrTrUrVr?r>)z User Timez System Timez User+Systemz Wall TimeInstrNamez[a-zA-Z][a-zA-Z+ ]+rAz\s*((?:[0-9]+\.)?[0-9]+)NrDrEz\s+(?:z\s*\(z%\)|-+)gz\s*(.*)rBrz Analysis execution timing reportz'unexpected text after parser finished: r() splitlinesiterrematchfindallstripr}r5_fieldsragroupszipfloatupdater>r ValueError)rilines colheadermulticolheaders line_iter header_maplnm raw_headerskheadersattrsrwpatmissingvdatar>rec remainings rparsez,ProcessedPassTimings._process..parses`'')E&I!))D9OU I$',#&# J  HH_b1"$**-CR"HK>IJz!'')4JGJ  2;+- --E+ACSb\ 8 %1HCLLA3e-LLA3h0fQCuQCw77C  8G%-- %E>a;&6!$GAJ % : C HHS"%=#AHHJ/H(+E8(<> $11=uQxcA>D>KK( ( I*"+/3CI}}/   ),I2Y> >ykJ[K6>s=A G G'GA7G9G?)G)(GG+9G%5G)rarhrd)rrrbs rrzProcessedPassTimings._processs) H VuT^^,-w''rN)r)r#r$r%r&r/rlrnrqrpryrrrsrr(rrr r sD "$14$6R(rr NamedTimingsnametimingscreZdZdZdZedZedZdZdZ dZ e dZ dd Z d Zd Zd Zy )PassTimingsCollectionzA collection of pass timings. This class implements the ``Sequence`` protocol for accessing the individual timing records. c ||_g|_yr-)_name_records)rrs rr/zPassTimingsCollection.__init__Es  rc#Ktjr=t5}ddddj}|r|j ||yydy#1swY4xYww)aRecord new timings and append to this collection. Note: this is mainly for internal use inside the compiler pipeline. See also ``RecordLLVMPassTimingsLegacy`` Parameters ---------- name: str Name for the records. N)rLLVM_PASS_TIMINGSr r!_append)rrrrs r record_legacyz#PassTimingsCollection.record_legacyIsV  # #,. ' ++-C T3'   sA!A3A!AA!c#Ktjr>t|5}ddddj}|r|j ||yydy#1swY4xYww)aRecord new timings and append to this collection. Note: this is mainly for internal use inside the compiler pipeline. See also ``RecordLLVMPassTimings`` Parameters ---------- name: str Name for the records. N)rrr*r!r)rrr.rrs rrecordzPassTimingsCollection.recordbsX  # #&r* g ++-C T3'   sA"A3A"AA"cN|jjt||y)zAppend timing records Parameters ---------- name: str Name for the records. timings: ProcessedPassTimings the timing records. N)rr}r)rrrs rrzPassTimingsCollection._append{s \$89rcT|jrtd|jDSy)zComputes the sum of the total time across all contained timings. Returns ------- res: float or None Returns the total number of seconds or None if no timings were recorded c3PK|]}|jj ywr-rrq).0rs r z7PassTimingsCollection.get_total_time..sIaqyy//1Is$&N)rsumrs rrqz$PassTimingsCollection.get_total_times# ==I4==II Irc4t|jddS)zReturns the timings in descending order of total time duration. Returns ------- res: List[ProcessedPassTimings] c6|jjSr-rrYs rr[z:PassTimingsCollection.list_longest_first..sAII$<$<$>rT)rxreverse)sortedrrs rlist_longest_firstz(PassTimingsCollection.list_longest_firstsdmm>"$ $rc|j S)z rrs ris_emptyzPassTimingsCollection.is_emptys==  rc|jryg}|j}|d|j|j}|d|dt |j D]m\}}|d|d|j |jj|z dz}|d|d d ||jj|d od j|S)aReturn a string representing the summary of the timings. Parameters ---------- topn: int; optional, default=5. This limits the maximum number of items to show. This function will show the ``topn`` most time-consuming passes. Returns ------- res: str See also ``ProcessedPassTimings.summary()`` zNo pass timings were recordedzPrinting pass timings for z Total time: rz== #r{dz Percent: z.1f%)rrr) rr}rrq enumeraterrrrr)rrrr overall_timeirpercents rrzPassTimingsCollection.summarys ==2CB +DJJ<8 9..0L l3/0 1!$--0 ;1T!AaffX&'))224|CcIZ}A./199$$$q$9:  ; 99S> !rc |j|S)zGet the i-th timing record. Returns ------- res: (name, timings) A named tuple with two fields: - name: str - timings: ProcessedPassTimings r)rrs r __getitem__z!PassTimingsCollection.__getitem__s}}Qrc,t|jS)z#Length of this collection. )lenrrs r__len__zPassTimingsCollection.__len__s4==!!rc"|jSr-)rrs r__str__zPassTimingsCollection.__str__s||~rN)r)r#r$r%r&r/rrrrrqrpropertyrrrrrr(rrrr>sk 00 :  $!! "<  " rr)rrOru collectionsrcollections.abcr contextlibr functoolsr numba.corerllvmlite.bindingbindingrr r*r5rdr rrr(rrrs~  "$%%00:00@ "*%Zo(o(d.69*=> YHYr